SCOPe 2.05: Domain d1q82f_: 1q82 F:

Lineage for d1q82f_ (1q82 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
   Uniprot P14124

8. Domain d1q82f_: 1q82 F: [96132]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82f_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

PDB Compounds: (F:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1q82f_:

Sequence, based on SEQRES records:

>d1q82f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records):

>d1q82f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

Timeline for d1q82f_:

• d1q82f_ first appeared in SCOP 1.67
  
• d1q82f_ appears in SCOPe 2.04
  
• d1q82f_ appears in SCOPe 2.06
  
• d1q82f_ appears in the current release, SCOPe 2.08