Lineage for d1q82d_ (1q82 D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126852Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 1126853Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1126894Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 1126940Domain d1q82d_: 1q82 D: [96130]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82d_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (D:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1q82d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82d_ b.43.3.2 (D:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1q82d_:

Click to download the PDB-style file with coordinates for d1q82d_.
(The format of our PDB-style files is described here.)

Timeline for d1q82d_: