Lineage for d1q82c2 (1q82 C:1-90)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463770Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 463771Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (19 PDB entries)
    includes the N-terminal tail
  8. 463779Domain d1q82c2: 1q82 C:1-90 [96129]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_

Details for d1q82c2

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82c2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOP Domain Coordinates for d1q82c2:

Click to download the PDB-style file with coordinates for d1q82c2.
(The format of our PDB-style files is described here.)

Timeline for d1q82c2: