Lineage for d1q824_ (1q82 4:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464553Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1464658Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
    automatically mapped to Pfam PF00935
  6. 1464659Protein Ribosomal protein L44e [57837] (1 species)
  7. 1464660Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1464690Domain d1q824_: 1q82 4: [96127]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q824_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (4:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1q824_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q824_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1q824_:

Click to download the PDB-style file with coordinates for d1q824_.
(The format of our PDB-style files is described here.)

Timeline for d1q824_: