Lineage for d1q823_ (1q82 3:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649539Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 649540Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 649541Protein Ribosomal protein L39e [48664] (1 species)
  7. 649542Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 649558Domain d1q823_: 1q82 3: [96126]
    Other proteins in same PDB: d1q821_, d1q822_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q823_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (3:) 50S ribosomal protein L39e

SCOP Domain Sequences for d1q823_:

Sequence, based on SEQRES records: (download)

>d1q823_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1q823_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1q823_:

Click to download the PDB-style file with coordinates for d1q823_.
(The format of our PDB-style files is described here.)

Timeline for d1q823_: