Lineage for d1q822_ (1q82 2:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263613Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 2263614Protein Ribosomal protein L37e [57834] (1 species)
  7. 2263615Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 2263645Domain d1q822_: 1q82 2: [96125]
    Other proteins in same PDB: d1q821_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q822_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (2:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1q822_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q822_ g.41.8.2 (2:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1q822_:

Click to download the PDB-style file with coordinates for d1q822_.
(The format of our PDB-style files is described here.)

Timeline for d1q822_: