Lineage for d1q81z_ (1q81 Z:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111376Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2111434Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2111435Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2111436Protein Ribosomal protein L32e [52044] (1 species)
  7. 2111437Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2111474Domain d1q81z_: 1q81 Z: [96123]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81z_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (Z:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1q81z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81z_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1q81z_:

Click to download the PDB-style file with coordinates for d1q81z_.
(The format of our PDB-style files is described here.)

Timeline for d1q81z_: