Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) automatically mapped to Pfam PF00831 |
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries) Uniprot P10971 |
Domain d1q81w_: 1q81 W: [96120] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81x_, d1q81y_, d1q81z_ protein/RNA complex; complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOPe Domain Sequences for d1q81w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d1q81w_:
View in 3D Domains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81x_, d1q81y_, d1q81z_ |