Lineage for d1q81o_ (1q81 O:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587067Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 587068Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 587069Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 587070Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries)
  8. 587077Domain d1q81o_: 1q81 O: [96112]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81o_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1q81o_:

Click to download the PDB-style file with coordinates for d1q81o_.
(The format of our PDB-style files is described here.)

Timeline for d1q81o_: