SCOP 1.71: Domain d1q813_: 1q81 3:

Lineage for d1q813_ (1q81 3:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
   not a true fold

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)

8. Domain d1q813_: 1q81 3: [96096]
   Other proteins in same PDB: d1q811_, d1q812_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q813_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q813_:

Sequence, based on SEQRES records:

>d1q813_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1q813_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1q813_:

• d1q813_ first appeared in SCOP 1.67
  
• d1q813_ appears in SCOP 1.69
  
• d1q813_ appears in SCOP 1.73
  
• d1q813_ appears in the current release, SCOPe 2.08