Lineage for d1q7yy_ (1q7y Y:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858025Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 858026Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 858027Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 858028Protein Ribosomal protein L31e [54577] (1 species)
  7. 858029Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 858068Domain d1q7yy_: 1q7y Y: [96088]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yy_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (Y:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1q7yy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yy_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1q7yy_:

Click to download the PDB-style file with coordinates for d1q7yy_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yy_: