SCOP 1.67: Domain d1q7yx_: 1q7y X:

Lineage for d1q7yx_ (1q7y X:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (18 PDB entries)

8. Domain d1q7yx_: 1q7y X: [96087]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yy_, d1q7yz_
   complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yx_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7yx_:

Sequence; same for both SEQRES and ATOM records:

>d1q7yx_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1q7yx_:

• d1q7yx_ is new in SCOP 1.67
  
• d1q7yx_ appears in SCOP 1.69
  
• d1q7yx_ appears in the current release, SCOPe 2.08