Lineage for d1q7yw_ (1q7y W:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 531989Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 531990Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 531991Protein Ribosomal protein L29 (L29p) [46563] (2 species)
  7. 531992Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)
  8. 532006Domain d1q7yw_: 1q7y W: [96086]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yx_, d1q7yy_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yw_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7yw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1q7yw_:

Click to download the PDB-style file with coordinates for d1q7yw_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yw_: