SCOP 1.67: Domain d1q7yu_: 1q7y U:

Lineage for d1q7yu_ (1q7y U:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (18 PDB entries)

8. Domain d1q7yu_: 1q7y U: [96084]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
   complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yu_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7yu_:

Sequence; same for both SEQRES and ATOM records:

>d1q7yu_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1q7yu_:

• d1q7yu_ is new in SCOP 1.67
  
• d1q7yu_ appears in SCOP 1.69
  
• d1q7yu_ appears in the current release, SCOPe 2.08