Lineage for d1q7yq_ (1q7y Q:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093554Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1093555Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 1093556Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1093557Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1093558Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1093615Domain d1q7yq_: 1q7y Q: [96080]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yq_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (Q:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1q7yq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yq_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1q7yq_:

Click to download the PDB-style file with coordinates for d1q7yq_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yq_: