SCOPe 2.06: Domain d1q7yi_: 1q7y I:

Lineage for d1q7yi_ (1q7y I:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1q7yi_: 1q7y I: [96072]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
   protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yi_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

PDB Compounds: (I:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1q7yi_:

Sequence, based on SEQRES records:

>d1q7yi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1q7yi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1q7yi_:

• d1q7yi_ first appeared in SCOP 1.67
  
• d1q7yi_ appears in SCOPe 2.05
  
• d1q7yi_ appears in SCOPe 2.07
  
• d1q7yi_ appears in the current release, SCOPe 2.08