SCOP 1.67: Domain d1q7yh_: 1q7y H:

Lineage for d1q7yh_ (1q7y H:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (18 PDB entries)

8. Domain d1q7yh_: 1q7y H: [96071]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
   complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yh_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7yh_:

Sequence; same for both SEQRES and ATOM records:

>d1q7yh_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1q7yh_:

• d1q7yh_ is new in SCOP 1.67
  
• d1q7yh_ appears in SCOP 1.69
  
• d1q7yh_ appears in the current release, SCOPe 2.08