Lineage for d1q7yc1 (1q7y C:91-237)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054808Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2054809Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2054847Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 2054886Domain d1q7yc1: 1q7y C:91-237 [96064]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yc1

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (C:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1q7yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yc1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOPe Domain Coordinates for d1q7yc1:

Click to download the PDB-style file with coordinates for d1q7yc1.
(The format of our PDB-style files is described here.)

Timeline for d1q7yc1: