Lineage for d1q7y3_ (1q7y 3:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544788Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 544789Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 544790Protein Ribosomal protein L39e [48664] (1 species)
  7. 544791Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 544805Domain d1q7y3_: 1q7y 3: [96062]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7y3_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7y3_:

Sequence, based on SEQRES records: (download)

>d1q7y3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1q7y3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1q7y3_:

Click to download the PDB-style file with coordinates for d1q7y3_.
(The format of our PDB-style files is described here.)

Timeline for d1q7y3_: