Lineage for d1q7y2_ (1q7y 2:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245406Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 1245407Protein Ribosomal protein L37e [57834] (1 species)
  7. 1245408Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1245447Domain d1q7y2_: 1q7y 2: [96061]
    Other proteins in same PDB: d1q7y1_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7y2_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (2:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1q7y2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7y2_ g.41.8.2 (2:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1q7y2_:

Click to download the PDB-style file with coordinates for d1q7y2_.
(The format of our PDB-style files is described here.)

Timeline for d1q7y2_: