SCOPe 2.08: Domain d1q7xa1: 1q7x A:2-108

Lineage for d1q7xa1 (1q7x A:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Phosphatase hPTP1e [50168] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50169] (9 PDB entries)

8. Domain d1q7xa1: 1q7x A:2-108 [96059]
   Other proteins in same PDB: d1q7xa2
   alternatively spliced PDZ2 domain

Details for d1q7xa1

PDB Entry: 1q7x

PDB Description: solution structure of the alternatively spliced pdz2 domain (pdz2b) of ptp-bas (hptp1e)

PDB Compounds: (A:) PDZ2b domain of PTP-Bas (hPTP1E)

SCOPe Domain Sequences for d1q7xa1:

Sequence; same for both SEQRES and ATOM records:

>d1q7xa1 b.36.1.1 (A:2-108) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
ssppkpgdifevelakndnslgisvtvlfdkggvntsvrhggiyvkavipqgaaesdgri
hkgdrvlavngvslegathkqavetlrntgqvvhlllekgqsptske

Timeline for d1q7xa1:

• d1q7xa1 first appeared in SCOP 1.67, called d1q7xa_
  
• d1q7xa1 appears in SCOPe 2.07