Lineage for d1q7tb_ (1q7t B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151803Fold c.134: LmbE-like [102587] (1 superfamily)
    3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases
  4. 2151804Superfamily c.134.1: LmbE-like [102588] (2 families) (S)
  5. 2151805Family c.134.1.1: LmbE-like [102589] (3 protein domains)
    putative deacetylases
  6. 2151806Protein 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD [102590] (1 species)
  7. 2151807Species Mycobacterium tuberculosis [TaxId:1773] [102591] (2 PDB entries)
    gene Rv1170
  8. 2151813Domain d1q7tb_: 1q7t B: [96058]
    Other proteins in same PDB: d1q7ta2
    complexed with bog, so4

Details for d1q7tb_

PDB Entry: 1q7t (more details), 1.9 Å

PDB Description: Rv1170 (MshB) from Mycobacterium tuberculosis
PDB Compounds: (B:) hypothetical protein Rv1170

SCOPe Domain Sequences for d1q7tb_:

Sequence, based on SEQRES records: (download)

>d1q7tb_ c.134.1.1 (B:) 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
etprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadhad
qlggyrigeltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvgalv
aiirelrphvvvtydpnggyghpdhvhthtvttaavaaagvgsgtadhpgdpwtvpkfyw
tvlglsalisgaralvpddlrpewvlpradeiafgysddgidavveadeqaraakvaala
ahatqvvvgptgraaalsnnlalpiladehyvlaggsagardergwetdllaglgft

Sequence, based on observed residues (ATOM records): (download)

>d1q7tb_ c.134.1.1 (B:) 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
etprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadhad
qlggyrigeltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvgalv
aiirelrphvvvtydpnggyghpdhvhthtvttaavaaagvgpgdpwtvpkfywtvlgls
alisgaralvpddlrpewvlpradeiafgysddgidavveadeqaraakvaalaahatqv
vvgptgraaalsnnlalpiladehyvlaggsagardergwetdllaglgft

SCOPe Domain Coordinates for d1q7tb_:

Click to download the PDB-style file with coordinates for d1q7tb_.
(The format of our PDB-style files is described here.)

Timeline for d1q7tb_: