Lineage for d1q7sb_ (1q7s B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405116Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 405117Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (1 family) (S)
  5. 405118Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (2 proteins)
    UPF0099: Pfam01981
  6. 405119Protein Bit1 (Cgi-147) [102464] (1 species)
    Peptidyl-tRNA hydrolase; involved in apoptosis
  7. 405120Species Human (Homo sapiens) [TaxId:9606] [102465] (1 PDB entry)
  8. 405122Domain d1q7sb_: 1q7s B: [96056]

Details for d1q7sb_

PDB Entry: 1q7s (more details), 2 Å

PDB Description: Crystal structure of bit1

SCOP Domain Sequences for d1q7sb_:

Sequence, based on SEQRES records: (download)

>d1q7sb_ c.131.1.1 (B:) Bit1 (Cgi-147) {Human (Homo sapiens)}
eykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapde
etliallahakmlgltvsliqdagrtqiapgsqtvlgigpgpadlidkvtghlkly

Sequence, based on observed residues (ATOM records): (download)

>d1q7sb_ c.131.1.1 (B:) Bit1 (Cgi-147) {Human (Homo sapiens)}
eykmilvvrndlkmgkgkvaaqcshaavsaykqiqrrnpemlkqweycgqpkvvvkapde
etliallahakmlgltvsliqdatqiapgsqtvlgigpgpadlidkvtghlkly

SCOP Domain Coordinates for d1q7sb_:

Click to download the PDB-style file with coordinates for d1q7sb_.
(The format of our PDB-style files is described here.)

Timeline for d1q7sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q7sa_