Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein Hypothetical protein YaaE [102250] (4 species) glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis |
Species Bacillus stearothermophilus [TaxId:1422] [102252] (1 PDB entry) |
Domain d1q7ra_: 1q7r A: [96054] structural genomics complexed with cl, edo, so4 |
PDB Entry: 1q7r (more details), 1.9 Å
SCOPe Domain Sequences for d1q7ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} lyfqsnmkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrl idryglmeplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqres feaelsikgvgdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfhpeltd dhrlmqyflnmvkeakmasslk
Timeline for d1q7ra_: