Lineage for d1q7qa1 (1q7q A:301-565)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386884Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 386903Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (2 proteins)
  6. 386904Protein Cobalamin-dependent methionine synthase MetH, C-terminal domain [102104] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 386905Species Thermotoga maritima [TaxId:243274] [102105] (6 PDB entries)
  8. 386916Domain d1q7qa1: 1q7q A:301-565 [96050]
    Other proteins in same PDB: d1q7qa2, d1q7qb2

Details for d1q7qa1

PDB Entry: 1q7q (more details), 3.1 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic)

SCOP Domain Sequences for d1q7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7qa1 c.1.21.2 (A:301-565) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima}
favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
detlmktlnatlvilekkelpraev

SCOP Domain Coordinates for d1q7qa1:

Click to download the PDB-style file with coordinates for d1q7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1q7qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7qa2