Lineage for d1q7ma2 (1q7m A:1-300)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386994Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 386995Family c.1.26.1: Homocysteine S-methyltransferase [82283] (2 proteins)
    Pfam 02574
  6. 387007Protein Cobalamin-dependent methionine synthase MetH, N-terminal domain [102108] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 387008Species Thermotoga maritima [TaxId:243274] [102109] (6 PDB entries)
  8. 387015Domain d1q7ma2: 1q7m A:1-300 [96047]
    Other proteins in same PDB: d1q7ma1, d1q7mb1

Details for d1q7ma2

PDB Entry: 1q7m (more details), 2.1 Å

PDB Description: cobalamin-dependent methionine synthase (meth) from thermotoga maritima (oxidized, monoclinic)

SCOP Domain Sequences for d1q7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ma2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

SCOP Domain Coordinates for d1q7ma2:

Click to download the PDB-style file with coordinates for d1q7ma2.
(The format of our PDB-style files is described here.)

Timeline for d1q7ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7ma1