SCOPe 2.06: Domain d1q7l.1: 1q7l A:,B:

Lineage for d1q7l.1 (1q7l A:,B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminoacylase-1, catalytic domain [102511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102512] (1 PDB entry)

8. Domain d1q7l.1: 1q7l A:,B: [96044]
   catalytic domain only made of the two separate chains
   complexed with gly, zn; mutant

Details for d1q7l.1

PDB Entry: 1q7l, 1.4 Å

PDB Description: zn-binding domain of the t347g mutant of human aminoacylase-i

PDB Compounds: (A:) Aminoacylase-1, (B:) Aminoacylase-1

SCOPe Domain Sequences for d1q7l.1:

Sequence; same for both SEQRES and ATOM records:

>g1q7l.1 c.56.5.4 (A:,B:) Aminoacylase-1, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
eeehpsvtlfrqylrirtvqpkpdygaavaffeetarqlglgcqkvevapgyvvtvltwp
gtnptlssillnshtdvvpvfkehwshdpfeafkdsegyiyargaqdmkcvsiqyleavr
rlkveghrfprtihmtfvpdeevgghqgmelfvqrpefhalragfaldegianptdaftv
fyserspwwvrvXnpwwaafsrvckdmnltlepeimpaagdnryiravgvpalgfspmnr
tpvllhdhderlheavflrgvdiytrllpalasvpalpsds

Timeline for d1q7l.1:

• d1q7l.1 first appeared in SCOP 1.67
  
• d1q7l.1 appears in SCOPe 2.05
  
• d1q7l.1 appears in SCOPe 2.07
  
• d1q7l.1 appears in the current release, SCOPe 2.08