SCOPe 2.06: Domain d1q7ha2: 1q7h A:3-68

Lineage for d1q7ha2 (1q7h A:3-68)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.2: Hypothetical protein Ta1423, N-terminal domain [102820] (1 protein)
   automatically mapped to Pfam PF09183

6. Protein Hypothetical protein Ta1423, N-terminal domain [102821] (1 species)
   this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase

7. Species Thermoplasma acidophilum [TaxId:2303] [102822] (1 PDB entry)

8. Domain d1q7ha2: 1q7h A:3-68 [96043]
   Other proteins in same PDB: d1q7ha1
   structural genomics
   complexed with zn

Details for d1q7ha2

PDB Entry: 1q7h, 2.1 Å

PDB Description: structure of a conserved pua domain protein from thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1q7ha2:

Sequence; same for both SEQRES and ATOM records:

>d1q7ha2 d.17.6.2 (A:3-68) Hypothetical protein Ta1423, N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
skhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsvyl
lnyrnp

Timeline for d1q7ha2:

• d1q7ha2 first appeared in SCOP 1.67
  
• d1q7ha2 appears in SCOPe 2.05
  
• d1q7ha2 appears in SCOPe 2.07
  
• d1q7ha2 appears in the current release, SCOPe 2.08