Lineage for d1q7ha2 (1q7h A:3-68)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 856194Superfamily d.17.6: Pre-PUA domain [88802] (5 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 856206Family d.17.6.2: Hypothetical protein Ta1423, N-terminal domain [102820] (1 protein)
  6. 856207Protein Hypothetical protein Ta1423, N-terminal domain [102821] (1 species)
    this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase
  7. 856208Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102822] (1 PDB entry)
  8. 856209Domain d1q7ha2: 1q7h A:3-68 [96043]
    Other proteins in same PDB: d1q7ha1
    structural genomics
    complexed with zn

Details for d1q7ha2

PDB Entry: 1q7h (more details), 2.1 Å

PDB Description: structure of a conserved pua domain protein from thermoplasma acidophilum
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d1q7ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ha2 d.17.6.2 (A:3-68) Hypothetical protein Ta1423, N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
skhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsvyl
lnyrnp

SCOP Domain Coordinates for d1q7ha2:

Click to download the PDB-style file with coordinates for d1q7ha2.
(The format of our PDB-style files is described here.)

Timeline for d1q7ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7ha1