![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.6: Pre-PUA domain [88802] (5 families) ![]() this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
![]() | Family d.17.6.2: Hypothetical protein Ta1423, N-terminal domain [102820] (1 protein) |
![]() | Protein Hypothetical protein Ta1423, N-terminal domain [102821] (1 species) this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase |
![]() | Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102822] (1 PDB entry) |
![]() | Domain d1q7ha2: 1q7h A:3-68 [96043] Other proteins in same PDB: d1q7ha1 structural genomics complexed with zn |
PDB Entry: 1q7h (more details), 2.1 Å
SCOP Domain Sequences for d1q7ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q7ha2 d.17.6.2 (A:3-68) Hypothetical protein Ta1423, N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} skhfiskkeakriweqmsrygiditgeslevaaqksasayyiggkpmvfqagdlipsvyl lnyrnp
Timeline for d1q7ha2: