SCOP 1.75: Domain d1q7ha1: 1q7h A:69-153

Lineage for d1q7ha1 (1q7h A:69-153)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Hypothetical protein Ta1423, C-terminal domain [102025] (1 species)
   this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102026] (1 PDB entry)

8. Domain d1q7ha1: 1q7h A:69-153 [96042]
   Other proteins in same PDB: d1q7ha2
   structural genomics
   complexed with zn

Details for d1q7ha1

PDB Entry: 1q7h, 2.1 Å

PDB Description: structure of a conserved pua domain protein from thermoplasma acidophilum

PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d1q7ha1:

Sequence; same for both SEQRES and ATOM records:

>d1q7ha1 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
srnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgmaemdage
vmatkrgkaariihfpgdelirafp

Timeline for d1q7ha1:

• d1q7ha1 first appeared in SCOP 1.67
  
• d1q7ha1 appears in SCOP 1.73
  
• d1q7ha1 appears in SCOPe 2.01
  
• d1q7ha1 appears in the current release, SCOPe 2.08