Lineage for d1q7ha1 (1q7h A:69-153)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383312Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 383313Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 383314Family b.122.1.1: PUA domain [88698] (3 proteins)
    RNA-binding domain
  6. 383325Protein Hypothetical protein Ta1423, C-terminal domain [102025] (1 species)
    this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase
  7. 383326Species Archaeon Thermoplasma acidophilum [TaxId:2303] [102026] (1 PDB entry)
  8. 383327Domain d1q7ha1: 1q7h A:69-153 [96042]
    Other proteins in same PDB: d1q7ha2
    structural genomics
    complexed with zn

Details for d1q7ha1

PDB Entry: 1q7h (more details), 2.1 Å

PDB Description: structure of a conserved pua domain protein from thermoplasma acidophilum

SCOP Domain Sequences for d1q7ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ha1 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, C-terminal domain {Archaeon Thermoplasma acidophilum}
srnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgmaemdage
vmatkrgkaariihfpgdelirafp

SCOP Domain Coordinates for d1q7ha1:

Click to download the PDB-style file with coordinates for d1q7ha1.
(The format of our PDB-style files is described here.)

Timeline for d1q7ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7ha2