![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
![]() | Protein Hypothetical protein Ta1423, C-terminal domain [102025] (1 species) this protein is related to the C-terminal part (domains C2 and C3) of Archaeosine tRNA-guanine transglycosylase |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [102026] (1 PDB entry) |
![]() | Domain d1q7ha1: 1q7h A:69-153 [96042] Other proteins in same PDB: d1q7ha2 structural genomics complexed with zn |
PDB Entry: 1q7h (more details), 2.1 Å
SCOPe Domain Sequences for d1q7ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q7ha1 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} srnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgmaemdage vmatkrgkaariihfpgdelirafp
Timeline for d1q7ha1: