Lineage for d1q7bc_ (1q7b C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574554Protein beta-keto acyl carrier protein reductase [51788] (5 species)
  7. 574555Species Escherichia coli [TaxId:562] [51790] (3 PDB entries)
  8. 574560Domain d1q7bc_: 1q7b C: [96028]

Details for d1q7bc_

PDB Entry: 1q7b (more details), 2.05 Å

PDB Description: The structure of betaketoacyl-[ACP] reductase from E. coli in complex with NADP+

SCOP Domain Sequences for d1q7bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7bc_ c.2.1.2 (C:) beta-keto acyl carrier protein reductase {Escherichia coli}
nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
mrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvvap
gfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
ymv

SCOP Domain Coordinates for d1q7bc_:

Click to download the PDB-style file with coordinates for d1q7bc_.
(The format of our PDB-style files is described here.)

Timeline for d1q7bc_: