SCOP 1.67: Domain d1q77b_: 1q77 B:

Lineage for d1q77b_ (1q77 B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (3 proteins)

6. Protein Hypothetical protein Aq_178 [102266] (1 species)
   putative universal stress protein

7. Species Aquifex aeolicus [TaxId:63363] [102267] (1 PDB entry)

8. Domain d1q77b_: 1q77 B: [96024]
   structural genomics
   complexed with so4

Details for d1q77b_

PDB Entry: 1q77, 2.7 Å

PDB Description: X-ray crystal structure of putative Universal Stress Protein from Aquifex aeolicus

SCOP Domain Sequences for d1q77b_:

Sequence; same for both SEQRES and ATOM records:

>d1q77b_ c.26.2.4 (B:) Hypothetical protein Aq_178 {Aquifex aeolicus}
snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
aylckvidglnlaslivk

Timeline for d1q77b_:

• d1q77b_ is new in SCOP 1.67
  
• d1q77b_ appears in SCOP 1.69
  
• d1q77b_ appears in the current release, SCOPe 2.08, called d1q77b1