Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
Protein Hypothetical protein Aq_178 [102266] (1 species) putative universal stress protein |
Species Aquifex aeolicus [TaxId:63363] [102267] (1 PDB entry) |
Domain d1q77b1: 1q77 B:1-135 [96024] Other proteins in same PDB: d1q77a2, d1q77b2 structural genomics complexed with so4 |
PDB Entry: 1q77 (more details), 2.7 Å
SCOPe Domain Sequences for d1q77b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q77b1 c.26.2.4 (B:1-135) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} mkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfppeik eeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacypsayl ckvidglnlaslivk
Timeline for d1q77b1: