Lineage for d1q77b1 (1q77 B:1-135)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861472Protein Hypothetical protein Aq_178 [102266] (1 species)
    putative universal stress protein
  7. 2861473Species Aquifex aeolicus [TaxId:63363] [102267] (1 PDB entry)
  8. 2861475Domain d1q77b1: 1q77 B:1-135 [96024]
    Other proteins in same PDB: d1q77a2, d1q77b2
    structural genomics
    complexed with so4

Details for d1q77b1

PDB Entry: 1q77 (more details), 2.7 Å

PDB Description: X-ray crystal structure of putative Universal Stress Protein from Aquifex aeolicus
PDB Compounds: (B:) Hypothetical protein AQ_178

SCOPe Domain Sequences for d1q77b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q77b1 c.26.2.4 (B:1-135) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]}
mkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfppeik
eeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacypsayl
ckvidglnlaslivk

SCOPe Domain Coordinates for d1q77b1:

Click to download the PDB-style file with coordinates for d1q77b1.
(The format of our PDB-style files is described here.)

Timeline for d1q77b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q77b2