Lineage for d1q74d_ (1q74 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151803Fold c.134: LmbE-like [102587] (1 superfamily)
    3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest; topological similarity to SAM-dependent methyltransferases
  4. 2151804Superfamily c.134.1: LmbE-like [102588] (2 families) (S)
  5. 2151805Family c.134.1.1: LmbE-like [102589] (3 protein domains)
    putative deacetylases
  6. 2151806Protein 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD [102590] (1 species)
  7. 2151807Species Mycobacterium tuberculosis [TaxId:1773] [102591] (2 PDB entries)
    gene Rv1170
  8. 2151811Domain d1q74d_: 1q74 D: [96022]
    complexed with pe4, zn

Details for d1q74d_

PDB Entry: 1q74 (more details), 1.7 Å

PDB Description: The Crystal Structure of 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB)
PDB Compounds: (D:) 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB)

SCOPe Domain Sequences for d1q74d_:

Sequence, based on SEQRES records: (download)

>d1q74d_ c.134.1.1 (D:) 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
setprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadha
dqlggyrigeltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvgal
vaiirelrphvvvtydpnggyghpdhvhthtvttaavaaagvgsgtadhpgdpwtvpkfy
wtvlglsalisgaralvpddlrpewvlpradeiafgysddgidavveadeqaraakvaal
aahatqvvvgptgraaalsnnlalpiladehyvlaggsagardergwetdllaglgf

Sequence, based on observed residues (ATOM records): (download)

>d1q74d_ c.134.1.1 (D:) 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
setprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadha
dqlggyrigeltaalralgvsapiylggagrwrdsgmaqrsqrrfvdadprqtvgalvai
irelrphvvvtydpnggyghpdhvhthtvttaavaaagvadhpgdpwtvpkfywtvlgls
alisgaralvpddlrpgysddgidavveadeqaraakvaalaahatqvvvgptgraaals
nnlalpiladehyvlaggsagardergwetdllaglgf

SCOPe Domain Coordinates for d1q74d_:

Click to download the PDB-style file with coordinates for d1q74d_.
(The format of our PDB-style files is described here.)

Timeline for d1q74d_: