SCOP 1.73: Domain d1q72h2: 1q72 H:114-228

Lineage for d1q72h2 (1q72 H:114-228)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1q72h2: 1q72 H:114-228 [96015]
   Other proteins in same PDB: d1q72h1, d1q72l1, d1q72l2
   part of anti-cocaine Fab M82G2
   complexed with coc

Details for d1q72h2

PDB Entry: 1q72, 1.7 Å

PDB Description: Anti-Cocaine Antibody M82G2 Complexed with Cocaine

PDB Compounds: (H:) Fab M82G2, Heavy chain

SCOP Domain Sequences for d1q72h2:

Sequence, based on SEQRES records:

>d1q72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
asttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavln
gdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk

Sequence, based on observed residues (ATOM records):

>d1q72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
asttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlngdl
ytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk

Timeline for d1q72h2:

• d1q72h2 first appeared in SCOP 1.67
  
• d1q72h2 appears in SCOP 1.71
  
• d1q72h2 appears in SCOP 1.75
  
• d1q72h2 appears in the current release, SCOPe 2.08