Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d1q72h2: 1q72 H:114-228 [96015] Other proteins in same PDB: d1q72h1, d1q72l1, d1q72l2 part of anti-cocaine Fab M82G2 complexed with coc |
PDB Entry: 1q72 (more details), 1.7 Å
SCOP Domain Sequences for d1q72h2:
Sequence, based on SEQRES records: (download)
>d1q72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} asttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavln gdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
>d1q72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} asttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlngdl ytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
Timeline for d1q72h2: