SCOPe 2.06: Domain d1q6ya1: 1q6y A:4-418

Lineage for d1q6ya1 (1q6y A:4-418)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
   consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit

4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families)

5. Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
   forms interlocked homodimer of two ring-like subunits

6. Protein Hypothetical protein YfdW [102709] (1 species)

7. Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)

8. Domain d1q6ya1: 1q6y A:4-418 [96012]
   Other proteins in same PDB: d1q6ya2, d1q6ya3
   structural genomics
   complexed with coa, mpd

Details for d1q6ya1

PDB Entry: 1q6y, 1.99 Å

PDB Description: hypothetical protein yfdw from e. coli bound to coenzyme a

PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1q6ya1:

Sequence; same for both SEQRES and ATOM records:

>d1q6ya1 c.123.1.1 (A:4-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

Timeline for d1q6ya1:

• d1q6ya1 first appeared in SCOP 1.67, called d1q6ya_
  
• d1q6ya1 was called d1q6ya_ in SCOPe 2.05
  
• d1q6ya1 appears in SCOPe 2.07
  
• d1q6ya1 appears in the current release, SCOPe 2.08