SCOPe 2.05: Domain d1q6ya_: 1q6y A:

Lineage for d1q6ya_ (1q6y A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
   consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit

4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families)

5. Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
   forms interlocked homodimer of two ring-like subunits

6. Protein Hypothetical protein YfdW [102709] (1 species)

7. Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)

8. Domain d1q6ya_: 1q6y A: [96012]
   structural genomics
   complexed with coa, mpd

Details for d1q6ya_

PDB Entry: 1q6y, 1.99 Å

PDB Description: hypothetical protein yfdw from e. coli bound to coenzyme a

PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1q6ya_:

Sequence; same for both SEQRES and ATOM records:

>d1q6ya_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
lstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhaie

Timeline for d1q6ya_:

• d1q6ya_ first appeared in SCOP 1.67
  
• d1q6ya_ appears in SCOPe 2.04
  
• d1q6ya_ is called d1q6ya1 in SCOPe 2.06
  
• d1q6ya_ appears in the current release, SCOPe 2.08, called d1q6ya1