Lineage for d1q6wj_ (1q6w J:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858756Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 858817Protein Monoamine oxidase regulatory protein [102905] (1 species)
  7. 858818Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102906] (1 PDB entry)
  8. 858828Domain d1q6wj_: 1q6w J: [96009]
    structural genomics

Details for d1q6wj_

PDB Entry: 1q6w (more details), 2.81 Å

PDB Description: x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius
PDB Compounds: (J:) monoamine oxidase regulatory protein, putative

SCOP Domain Sequences for d1q6wj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6wj_ d.38.1.4 (J:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
vvtyklevknqrgelvltalysalirktp

SCOP Domain Coordinates for d1q6wj_:

Click to download the PDB-style file with coordinates for d1q6wj_.
(The format of our PDB-style files is described here.)

Timeline for d1q6wj_: