Lineage for d1q6we_ (1q6w E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410666Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410667Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 410709Family d.38.1.4: MaoC-like [82636] (3 proteins)
  6. 410732Protein Monoamine oxidase regulatory protein [102905] (1 species)
  7. 410733Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102906] (1 PDB entry)
  8. 410738Domain d1q6we_: 1q6w E: [96004]

Details for d1q6we_

PDB Entry: 1q6w (more details), 2.81 Å

PDB Description: x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius

SCOP Domain Sequences for d1q6we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6we_ d.38.1.4 (E:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus}
arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
sgvvtyklevknqrgelvltalysalirktp

SCOP Domain Coordinates for d1q6we_:

Click to download the PDB-style file with coordinates for d1q6we_.
(The format of our PDB-style files is described here.)

Timeline for d1q6we_: