SCOP 1.67: Domain d1q6qb_: 1q6q B:

Lineage for d1q6qb_ (1q6q B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.3: Decarboxylase [51375] (2 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)

7. Species Escherichia coli [TaxId:562] [75051] (6 PDB entries)

8. Domain d1q6qb_: 1q6q B: [95991]
   complexed with lxp, mg

Details for d1q6qb_

PDB Entry: 1q6q, 1.7 Å

PDB Description: structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate

SCOP Domain Sequences for d1q6qb_:

Sequence; same for both SEQRES and ATOM records:

>d1q6qb_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelw

Timeline for d1q6qb_:

• d1q6qb_ is new in SCOP 1.67
  
• d1q6qb_ appears in SCOP 1.69
  
• d1q6qb_ appears in the current release, SCOPe 2.08