SCOPe 2.05: Domain d1q6ob_: 1q6o B:

Lineage for d1q6ob_ (1q6o B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)

7. Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
   Uniprot P39304

8. Domain d1q6ob_: 1q6o B: [95987]
   complexed with lg6, mg

Details for d1q6ob_

PDB Entry: 1q6o, 1.2 Å

PDB Description: structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l- gulonaet 6-phosphate

PDB Compounds: (B:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1q6ob_:

Sequence; same for both SEQRES and ATOM records:

>d1q6ob_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

Timeline for d1q6ob_:

• d1q6ob_ first appeared in SCOP 1.67
  
• d1q6ob_ appears in SCOPe 2.04
  
• d1q6ob_ appears in SCOPe 2.06
  
• d1q6ob_ appears in the current release, SCOPe 2.08