Lineage for d1q6oa_ (1q6o A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681365Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 681366Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
  8. 681367Domain d1q6oa_: 1q6o A: [95986]

Details for d1q6oa_

PDB Entry: 1q6o (more details), 1.2 Å

PDB Description: structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l- gulonaet 6-phosphate
PDB Compounds: (A:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOP Domain Sequences for d1q6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

SCOP Domain Coordinates for d1q6oa_:

Click to download the PDB-style file with coordinates for d1q6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1q6oa_: