SCOP 1.71: Domain d1q6oa_: 1q6o A:

Lineage for d1q6oa_ (1q6o A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families)

5. Family c.1.2.3: Decarboxylase [51375] (2 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)

7. Species Escherichia coli [TaxId:562] [75051] (10 PDB entries)

8. Domain d1q6oa_: 1q6o A: [95986]

Details for d1q6oa_

PDB Entry: 1q6o, 1.2 Å

PDB Description: structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l- gulonaet 6-phosphate

SCOP Domain Sequences for d1q6oa_:

Sequence; same for both SEQRES and ATOM records:

>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

Timeline for d1q6oa_:

• d1q6oa_ first appeared in SCOP 1.67
  
• d1q6oa_ appears in SCOP 1.69
  
• d1q6oa_ appears in SCOP 1.73
  
• d1q6oa_ appears in the current release, SCOPe 2.08