SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q6na1 (1q6n A:501-785)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116409Protein Tyrosine phosphatase [52806] (7 species)
  7. 2116410Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (117 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2116463Domain d1q6na1: 1q6n A:501-785 [95984]
    Other proteins in same PDB: d1q6na2, d1q6nb2
    complexed with cl, mg, p90

Details for d1q6na1

PDB Entry: 1q6n (more details), 2.1 Å

PDB Description: the structure of phosphotyrosine phosphatase 1b in complex with compound 4
PDB Compounds: (A:) protein-tyrosine phosphatase, non-receptor type 1

SCOPe Domain Sequences for d1q6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6na1 c.45.1.2 (A:501-785) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds

SCOPe Domain Coordinates for d1q6na1:

Click to download the PDB-style file with coordinates for d1q6na1.
(The format of our PDB-style files is described here.)

Timeline for d1q6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q6na2