Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein beta-Amylase [51481] (3 species) Common fold covers whole protein structure |
Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries) Uniprot P10538 |
Domain d1q6fa_: 1q6f A: [95973] complexed with so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q6f (more details), 2.1 Å
SCOPe Domain Sequences for d1q6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6fa_ c.1.8.1 (A:) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidiyvglgpag elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw lpetdmkvdg
Timeline for d1q6fa_: