SCOPe 2.05: Domain d1q6ea_: 1q6e A:

Lineage for d1q6ea_ (1q6e A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein beta-Amylase [51481] (3 species)
   Common fold covers whole protein structure

7. Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries)
   Uniprot P10538

8. Domain d1q6ea_: 1q6e A: [95972]
   complexed with so4; mutant

Details for d1q6ea_

PDB Entry: 1q6e, 1.95 Å

PDB Description: crystal structure of soybean beta-amylase mutant (e178y) with increased ph optimum at ph 5.4

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1q6ea_:

Sequence; same for both SEQRES and ATOM records:

>d1q6ea_ c.1.8.1 (A:) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]}
nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidiyvglgpag
elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
lpetdmkvdg

Timeline for d1q6ea_:

• d1q6ea_ first appeared in SCOP 1.67
  
• d1q6ea_ appears in SCOPe 2.04
  
• d1q6ea_ appears in SCOPe 2.06
  
• d1q6ea_ appears in the current release, SCOPe 2.08