Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein beta-Amylase [51481] (3 species) Common fold covers whole protein structure |
Species Soybean (Glycine max) [TaxId:3847] [51482] (15 PDB entries) |
Domain d1q6ea_: 1q6e A: [95972] complexed with glc, so4; mutant |
PDB Entry: 1q6e (more details), 1.95 Å
SCOP Domain Sequences for d1q6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6ea_ c.1.8.1 (A:) beta-Amylase {Soybean (Glycine max)} nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidiyvglgpag elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw lpetdmkvdg
Timeline for d1q6ea_: