SCOPe 2.05: Domain d1q6bb_: 1q6b B:

Lineage for d1q6bb_ (1q6b B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families)

5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)

6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)

7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
   Uniprot Q79V62 174-283

8. Domain d1q6bb_: 1q6b B: [95969]

Details for d1q6bb_

PDB Entry: 1q6b

PDB Description: Solution Structure of the C-terminal Domain of Thermosynechococcus elongatus KaiA (ThKaiA180C); Ensemble of 25 Structures

PDB Compounds: (B:) Circadian clock protein KaiA homolog

SCOPe Domain Sequences for d1q6bb_:

Sequence; same for both SEQRES and ATOM records:

>d1q6bb_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

Timeline for d1q6bb_:

• d1q6bb_ first appeared in SCOP 1.67
  
• d1q6bb_ appears in SCOPe 2.04
  
• d1q6bb_ is called d1q6bb1 in SCOPe 2.06
  
• d1q6bb_ appears in the current release, SCOPe 2.08, called d1q6bb1